"context" : "lia-deleted-state", "action" : "rerender" { "actions" : [ "selector" : "#messageview_9", "actions" : [ "actions" : [ "context" : "", }, }, }, "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "editProductMessage", } "displaySubject" : "true", "event" : "addMessageUserEmailSubscription", ] ] }, I had a very similar setup on Sky when I used their Sky Hub as a bridge to a DLink DIR868 and this worked fne but it seems either I'm missing something crucial or the Vodafone Connect does not play nicely if trying to use it as a bridge. { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); { } { { { { "componentId" : "kudos.widget.button", { "event" : "MessagesWidgetEditCommentForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); function processPageInputBlur(pagerId, val) "context" : "", element.removeClass('active'); } "quiltName" : "ForumMessage", { } "event" : "markAsSpamWithoutRedirect", { Bist du sicher, dass du fortfahren möchtest? "event" : "approveMessage", "context" : "envParam:quiltName,message", { } LITHIUM.AjaxSupport.ComponentEvents.set({ }, { "actions" : [ } "actions" : [ "action" : "rerender" "context" : "", "selector" : "#messageview_8", ] { "event" : "removeMessageUserEmailSubscription", "eventActions" : [ } { { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); "event" : "removeMessageUserEmailSubscription", { } } }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "action" : "rerender" "event" : "markAsSpamWithoutRedirect", ] { } if (doChecks(pagerId, val)) }); Check out this quick Vodafone Ninja video on setting up your Vodafone wireless modem. } "event" : "approveMessage", }); { } LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "action" : "rerender" }, "context" : "", }, { ] "action" : "rerender" "action" : "pulsate" { { "actions" : [ setCookie: function(cookieName, cookieValue) { } "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ "event" : "MessagesWidgetCommentForm", "linkDisabled" : "false" ] // --> "context" : "envParam:quiltName,product,contextId,contextUrl", $(document).keydown(function(e) { } "message" : "1682363", "action" : "rerender" "action" : "rerender" "truncateBody" : "true", { "context" : "", "message" : "1682145", LITHIUM.AjaxSupport.ComponentEvents.set({ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" { if (isNaN(val) ) "event" : "QuickReply", "context" : "envParam:selectedMessage", } "event" : "MessagesWidgetMessageEdit", I have 192.168.1.x as the range on my voda router ( only 1 address via dhcp.. "action" : "rerender" { LITHIUM.Dialog.options['553595914'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; ] } "action" : "rerender" { "parameters" : { "action" : "rerender" "actions" : [ }, } { { "initiatorDataMatcher" : "data-lia-kudos-id" } "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "action" : "pulsate" "context" : "", "actions" : [ { "actions" : [ "truncateBodyRetainsHtml" : "false", "action" : "pulsate" ] } ;(function($) { "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ { "context" : "envParam:feedbackData", } "revokeMode" : "true", "actions" : [ LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" "actions" : [ "quiltName" : "ForumMessage", "linkDisabled" : "false" { } ] { "action" : "rerender" "event" : "deleteMessage", { }, { "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/74551","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pKo3QkfvVn2B4raXWwo5GZyBXnBW2Sv0_p4ZVykc3Qs. { { { "event" : "MessagesWidgetEditAction", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "disableKudosForAnonUser" : "false", } { "event" : "markAsSpamWithoutRedirect", "event" : "ProductMessageEdit", // --> "event" : "editProductMessage", "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", Configurazione della Vodafone Station per utilizzare il modem alternativo per il servizio dati e della Vodafone Station in cascata per il servizio voce Qualora tu voglia utilizzare il tuo modem per navigare in Internet e voglia usufruire del servizio VoIP, è necessario configurare come segue, la Vodafone Station… var handleOpen = function(event) { { "selector" : "#messageview_1", } "context" : "", "componentId" : "forums.widget.message-view", { "actions" : [ } ] LITHIUM.InputEditForm("form_9", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" "event" : "removeThreadUserEmailSubscription", } } { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "QuickReply", }, LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] // If watching, pay attention to key presses, looking for right sequence. { "disallowZeroCount" : "false", setWarning(pagerId); "}); "event" : "markAsSpamWithoutRedirect", })(LITHIUM.jQuery); } "context" : "", "selector" : "#kudosButtonV2_2", ] { }, "action" : "rerender" { } "event" : "addMessageUserEmailSubscription", "action" : "rerender" "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); }, }, "actions" : [ }, }, } "includeRepliesModerationState" : "false", }, "context" : "", { "context" : "envParam:quiltName", DS Lite auf Dual-Stack umstellen GELÖST Start a topic. "forceSearchRequestParameterForBlurbBuilder" : "false", { "event" : "deleteMessage", { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } { } ], if ( key == neededkeys[0] ) { "event" : "removeThreadUserEmailSubscription", "action" : "pulsate" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); ] $(document).ready(function(){ "actions" : [ "dialogKey" : "dialogKey" "event" : "MessagesWidgetEditAnswerForm", { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "componentId" : "forums.widget.message-view", }, "event" : "removeMessageUserEmailSubscription", { "action" : "pulsate" } }, "context" : "", } } { } "action" : "rerender" { You can connect the Wan ethernet port of another router to the Vodafone router. }, "initiatorBinding" : true, { "action" : "rerender" ', 'ajax'); "event" : "kudoEntity", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_2.lineardisplaymessageviewwrapper_0:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/74551","ajaxErrorEventName":"LITHIUM:ajaxError","token":"scvWRvtSr_2jur3NYi-CLMxbVUTplOVNsScXL5U1EwU. var count = 0; $(this).toggleClass("view-btn-open view-btn-close"); "context" : "", }, "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "pulsate" } }, { "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'IP0D_zGavpwADrY3ryUwE7avwfvnUy7oWolyugFdU_A. ] "action" : "rerender" } "disallowZeroCount" : "false", Execute whatever should happen when entering the right sequence "context" : "envParam:selectedMessage", ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1682363 .lia-rating-control-passive', '#form_9'); "context" : "", { "includeRepliesModerationState" : "false", "quiltName" : "ForumMessage", ] "parameters" : { } { }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "ProductAnswerComment", "actions" : [ LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "event" : "ProductMessageEdit", } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1682136,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } } "displayStyle" : "horizontal", { "action" : "rerender" "action" : "rerender" } // Oops. "context" : "envParam:quiltName,message,product,contextId,contextUrl", { { LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); "actions" : [ { "linkDisabled" : "false" "event" : "editProductMessage", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); { "event" : "ProductAnswerComment", }); "revokeMode" : "true", ] } }, ] }, }, } }); "action" : "rerender" }, }); "action" : "rerender" "action" : "rerender" "actions" : [ ] "action" : "rerender" "context" : "", }, The other issue from the logs when I tried this, was that it is impossible to get UPnP working on the network when the Vodafone modem/router is connected. }); "event" : "MessagesWidgetAnswerForm", { } "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ "action" : "rerender" { } // Oops, not the right sequence, lets restart from the top. { "actions" : [ "action" : "rerender" } $(document).keydown(function(e) { "context" : "", ] "actions" : [ }); "event" : "MessagesWidgetEditAnswerForm", ] { } ] { "context" : "", "actions" : [ "revokeMode" : "true", "event" : "expandMessage", "kudosable" : "true", "disableKudosForAnonUser" : "false", if ( key == neededkeys[0] ) { "actions" : [ { }, setWarning(pagerId); "action" : "rerender" "useCountToKudo" : "false", "action" : "addClassName" "context" : "envParam:quiltName", "action" : "rerender" "context" : "envParam:selectedMessage", "kudosable" : "true", LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); "context" : "", { "context" : "lia-deleted-state", { "actions" : [ $('#node-menu li.has-sub>a').on('click', function(){ ] "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } "initiatorDataMatcher" : "data-lia-message-uid" clearWarning(pagerId); "disableLinks" : "false", "action" : "addClassName" "quiltName" : "ForumMessage", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { { "context" : "", count = 0; }, { }, "forceSearchRequestParameterForBlurbBuilder" : "false", }, LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "kudoEntity", } if ( watching ) { "context" : "lia-deleted-state", { { "context" : "envParam:quiltName", { } ] return false; $(event.data.selector).removeClass('cssmenu-open'); LITHIUM.AjaxSupport.ComponentEvents.set({ { } } "actions" : [ ] }, "event" : "addMessageUserEmailSubscription", "componentId" : "forums.widget.message-view", { "actions" : [ { "action" : "rerender" "useTruncatedSubject" : "true", "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ "actions" : [ } "actions" : [ "action" : "rerender" }, { "entity" : "1682273", { "linkDisabled" : "false" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "displayStyle" : "horizontal", "context" : "", ] LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_9","componentSelector":"#lineardisplaymessageviewwrapper_9","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1682363,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "componentId" : "kudos.widget.button", { } "action" : "rerender" "action" : "rerender" function clearWarning(pagerId) { Bist du sicher, dass du fortfahren möchtest? LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); ] { { { "action" : "rerender" { }, "initiatorBinding" : true, "event" : "QuickReply", }, ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "action" : "rerender" ] { { $(document).ready(function(){ "actions" : [ } "event" : "markAsSpamWithoutRedirect", "context" : "envParam:quiltName,product,contextId,contextUrl", }, } } // Oops. disableInput(pagerId); { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); ] "context" : "", } "actions" : [ "action" : "addClassName" { }, } LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ ] ] "initiatorDataMatcher" : "data-lia-message-uid" ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, "event" : "MessagesWidgetEditAction", } "componentId" : "kudos.widget.button", ] "actions" : [ ] } "useCountToKudo" : "false", "revokeMode" : "true", "context" : "", { count = 0; if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") "displayStyle" : "horizontal", { ] "actions" : [ })(LITHIUM.jQuery); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); "event" : "removeThreadUserEmailSubscription", ] } { "actions" : [ "event" : "ProductAnswer", { "parameters" : { return; "selector" : "#kudosButtonV2_4", } "context" : "", { { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); "action" : "rerender" "context" : "", }, ] } { $(document).ready(function(){ denke schon, vielen Dank für alle Antworten, werde dann diesen Post schliessen. count++; LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; { "}); ] ] "action" : "rerender" "context" : "envParam:entity", "event" : "ProductAnswerComment", "actions" : [ } ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1682289,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten.